Structure of PDB 4y6l Chain A Binding Site BS01

Receptor Information
>4y6l Chain A (length=277) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRNLEKYHLP
YPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLR
CYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKI
FSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTS
LQVQPFASLISKAPLSTPRLLINKEKAGMDFDSKKAYRDVAWLGECDQGC
LALAELLGWKKELEDLVRREHASIDAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y6l Kinetic and Structural Basis for Acyl-Group Selectivity and NAD(+) Dependence in Sirtuin-Catalyzed Deacylation.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		F96 F119 F143 H187 F190 V233 F235 G236 E237 S238 F244 Q265 V266 Q267 P268
Binding residue
(residue number reindexed from 1)		F41 F56 F80 H124 F127 V170 F172 G173 E174 S175 F181 Q202 V203 Q204 P205
Enzymatic activity
Catalytic site (original residue number in PDB) P94 D95 F96 R97 N168 D170 H187
Catalytic site (residue number reindexed from 1) P39 D40 F41 R42 N105 D107 H124
Enzyme Commision number 2.3.1.-
2.3.1.286: protein acetyllysine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0017136 NAD-dependent histone deacetylase activity
GO:0051287 NAD binding
GO:0070403 NAD+ binding

View graph for
Molecular Function
External links
PDB RCSB:4y6l, PDBe:4y6l, PDBj:4y6l
PDBsum4y6l
PubMed25897714
UniProtQ8IXJ6|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 (Gene Name=SIRT2)

[Back to BioLiP]