Structure of PDB 4y0f Chain A Binding Site BS01

Receptor Information
>4y0f Chain A (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF
TEYETQVKVMSQRHMIDGRWCDCKLPNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4y0f Structural analysis of disease-related TDP-43 D169G mutation: linking enhanced stability and caspase cleavage efficiency to protein accumulation
Resolution2.648 Å
Binding residue
(original residue number in PDB)		D105 I107 L109 G110 L111 W113 K136 L139 K145 G146 F147 F149 R171 P178 N179 S180
Binding residue
(residue number reindexed from 1)		D3 I5 L7 G8 L9 W11 K34 L37 K43 G44 F45 F47 R69 P76 N77 S78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4y0f, PDBe:4y0f, PDBj:4y0f
PDBsum4y0f
PubMed26883171
UniProtQ13148|TADBP_HUMAN TAR DNA-binding protein 43 (Gene Name=TARDBP)

[Back to BioLiP]