Structure of PDB 4y00 Chain A Binding Site BS01

Receptor Information

>4y00 Chain A (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRF
TEYETQVKVMSQRHMIGGRWCDCKLPNS

Ligand information

>4y00 Chain E (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgagcgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4y00 Structural analysis of disease-related TDP-43 D169G mutation: linking enhanced stability and caspase cleavage efficiency to protein accumulation
Resolution	3.0 Å
Binding residue (original residue number in PDB)	D105 L109 G110 L111 W113 Q134 K136 G146 F147 F149 R171 P178 N179
Binding residue (residue number reindexed from 1)	D3 L7 G8 L9 W11 Q32 K34 G44 F45 F47 R69 P76 N77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:4y00, PDBe:4y00, PDBj:4y00
PDBsum	4y00
PubMed	26883171
UniProt	Q13148\|TADBP_HUMAN TAR DNA-binding protein 43 (Gene Name=TARDBP)

[Back to BioLiP]