Structure of PDB 4xr2 Chain A Binding Site BS01

Receptor Information
>4xr2 Chain A (length=305) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLN
RIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDN
LSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVARHLPGLITLN
AYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWT
REEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHA
CPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLH
LYVAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xr2 Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		S88 K89 T129 R139 L153 Y156 R169 A173 N174 K175 H176 I178 K179 N180 R241 W243 Q250 V285 H287 R288 Q294
Binding residue
(residue number reindexed from 1)		S84 K85 T125 R135 L149 Y152 R165 A169 N170 K171 H172 I174 K175 N176 R237 W239 Q246 V281 H283 R284 Q290
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006274 DNA replication termination
GO:0071807 replication fork arrest involved in DNA replication termination
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xr2, PDBe:4xr2, PDBj:4xr2
PDBsum4xr2
PubMed26322585
UniProtP16525|TUS_ECOLI DNA replication terminus site-binding protein (Gene Name=tus)

[Back to BioLiP]