Structure of PDB 4xr1 Chain A Binding Site BS01

Receptor Information
>4xr1 Chain A (length=307) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYDLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNP
LNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQV
DNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLIT
LNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAP
WTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQ
HACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPR
LHLYVAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xr1 Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S88 K89 T129 R139 F140 L153 Y156 R169 A173 N174 K175 H176 I178 K179 N180 R241 W243 Q250 V285 H287 R288 P291 A293 Q294
Binding residue
(residue number reindexed from 1)		S86 K87 T127 R137 F138 L151 Y154 R167 A171 N172 K173 H174 I176 K177 N178 R239 W241 Q248 V283 H285 R286 P289 A291 Q292
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006274 DNA replication termination
GO:0071807 replication fork arrest involved in DNA replication termination
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xr1, PDBe:4xr1, PDBj:4xr1
PDBsum4xr1
PubMed26322585
UniProtP16525|TUS_ECOLI DNA replication terminus site-binding protein (Gene Name=tus)

[Back to BioLiP]