Structure of PDB 4xob Chain A Binding Site BS01

Receptor Information

>4xob Chain A (length=279) Species: 83333 (Escherichia coli K-12)

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPE
TITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTD
KPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYA
NNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGT
TADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSL
GLTANYARTGGQVTAGNVQSIIGVTFVYQ

Ligand information

>4xob Chain B (length=13) Species: 83333 (Escherichia coli K-12)

ADSTITIRGYVRD

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4xob Catch-bond mechanism of the bacterial adhesin FimH.
• Resolution: 3.003 Å
• Binding residue (original residue number in PDB): A115 G116 R166 D167 V168 T169 V170 T171 L172 D174 Y175 Y256 T264 A265 G266 N267 V268 Q269 S270 I271 I272 G273 V274 T275
• Binding residue (residue number reindexed from 1): A115 G116 R166 D167 V168 T169 V170 T171 L172 D174 Y175 Y256 T264 A265 G266 N267 V268 Q269 S270 I271 I272 G273 V274 T275

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005537 D-mannose binding

Biological Process

• GO:0007155 cell adhesion
• GO:0007638 mechanosensory behavior
• GO:0031589 cell-substrate adhesion
• GO:0043709 cell adhesion involved in single-species biofilm formation

Cellular Component

• GO:0009289 pilus
• GO:0009419 pilus tip
• GO:0033644 host cell membrane

External links

• PDB: RCSB:4xob, PDBe:4xob, PDBj:4xob
• PDBsum: 4xob
• PubMed: 26948702
• UniProt: P08191|FIMH_ECOLI Type 1 fimbrin D-mannose specific adhesin (Gene Name=fimH)