Structure of PDB 4xmh Chain A Binding Site BS01

Receptor Information
>4xmh Chain A (length=185) Species: 13249 (Rhodnius prolixus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPGECSVNVIPKKNLDKAKFFSGTWYETHYLDMDPQATEKFCFSFAPRES
GGTVKEALYHFNVDSKVSFYNTGTGPLESNGAKYTAKFNTVDKKGKEIKP
ADEKYSYTVTVIEAAKQSALIHICLQEDGKDIGDLYSVLNRNKNALPNKK
IKKALNKVSLVLTKFVVTKDLDCKYDDKFLSSWQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xmh Structure and dynamics of the membrane attaching nitric oxide transporter nitrophorin 7.
Resolution1.29 Å
Binding residue
(original residue number in PDB)		L125 G133
Binding residue
(residue number reindexed from 1)		L125 G133
Enzymatic activity
Enzyme Commision number 1.7.6.1: nitrite dismutase.
Gene Ontology
Molecular Function
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051381 histamine binding
GO:0070026 nitric oxide binding
Biological Process
GO:0033484 intracellular nitric oxide homeostasis
GO:0034776 response to histamine
GO:0042311 vasodilation
GO:0044552 vasodilation in another organism
GO:0050819 negative regulation of coagulation
GO:0070527 platelet aggregation
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xmh, PDBe:4xmh, PDBj:4xmh
PDBsum4xmh
PubMed26167269
UniProtQ6PQK2|NP7_RHOPR Nitrophorin-7

[Back to BioLiP]