Structure of PDB 4xek Chain A Binding Site BS01

Receptor Information
>4xek Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLR
KLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSL
SEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xek Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
Resolution1.793 Å
Binding residue
(original residue number in PDB)		K911 G914 L915 L917 R918 D925 K944 N947 L950
Binding residue
(residue number reindexed from 1)		K43 G46 L47 L49 R50 D57 K76 N79 L82
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004713 protein tyrosine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007172 signal complex assembly
Cellular Component
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xek, PDBe:4xek, PDBj:4xek
PDBsum4xek
PubMed26866573
UniProtQ14289|FAK2_HUMAN Protein-tyrosine kinase 2-beta (Gene Name=PTK2B)

[Back to BioLiP]