Structure of PDB 4xeg Chain A Binding Site BS01

Receptor Information
>4xeg Chain A (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFW
KCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFRE
GGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIP
DTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xeg Thymine DNA glycosylase exhibits negligible affinity for nucleobases that it removes from DNA.
Resolution1.72 Å
Binding residue
(original residue number in PDB)
P155 K246 A274 R275 A277 P280 R281
Binding residue
(residue number reindexed from 1)
P45 K136 A164 R165 A167 P170 R171
Enzymatic activity
Catalytic site (original residue number in PDB) N140 H151
Catalytic site (residue number reindexed from 1) N30 H41
Enzyme Commision number 3.2.2.29: thymine-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0000700 mismatch base pair DNA N-glycosylase activity
Biological Process
GO:0006285 base-excision repair, AP site formation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4xeg, PDBe:4xeg, PDBj:4xeg
PDBsum4xeg
PubMed26358812
UniProtQ13569|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase (Gene Name=TDG)

[Back to BioLiP]