Structure of PDB 4x8n Chain A Binding Site BS01

Receptor Information

>4x8n Chain A (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDE
MPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSG
YGQGDVLGFYINLPEGSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSC
TVSINFGPCFKYPPKDLTYRPMSDMG

Ligand information

>4x8n Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ERESEFDIED

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4x8n A phosphorylation switch on RbBP5 regulates histone H3 Lys4 methylation.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	G312 Y313 R343 P356 R367 F374 S377 Y475
Binding residue (residue number reindexed from 1)	G27 Y28 R58 P71 R82 F89 S92 Y147

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0048188	Set1C/COMPASS complex

View graph for
Cellular Component

External links

PDB	RCSB:4x8n, PDBe:4x8n, PDBj:4x8n
PDBsum	4x8n
PubMed	25593305
UniProt	Q9UBL3\|ASH2L_HUMAN Set1/Ash2 histone methyltransferase complex subunit ASH2 (Gene Name=ASH2L)

[Back to BioLiP]