Structure of PDB 4x5k Chain A Binding Site BS01

Receptor Information

>4x5k Chain A (length=153) Species: 9606 (Homo sapiens)

GSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFN
DIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEK
DGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQK
NLK

Ligand information

>4x5k Chain B (length=4) Species: 32630 (synthetic construct)

MMAS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4x5k Human NAA50 with coenzymeA and a peptide
• Resolution: 2.494 Å
• Binding residue (original residue number in PDB): F27 V29 Y31 Y73 M75 T76 L77 H112 Y138 Y139 K140
• Binding residue (residue number reindexed from 1): F25 V27 Y29 Y71 M73 T74 L75 H110 Y136 Y137 K138

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.

Gene Ontology

Molecular Function

• GO:0004596 peptide alpha-N-acetyltransferase activity
• GO:0005515 protein binding
• GO:0010485 histone H4 acetyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0061733 peptide-lysine-N-acetyltransferase activity
• GO:0120518 peptide-methionine-alpha-N-acetyltransferase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006474 N-terminal protein amino acid acetylation
• GO:0007064 mitotic sister chromatid cohesion
• GO:0034087 establishment of mitotic sister chromatid cohesion
• GO:0071962 mitotic sister chromatid cohesion, centromeric

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031415 NatA complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4x5k, PDBe:4x5k, PDBj:4x5k
• PDBsum: 4x5k
• UniProt: Q9GZZ1|NAA50_HUMAN N-alpha-acetyltransferase 50 (Gene Name=NAA50)