Structure of PDB 4x3i Chain A Binding Site BS01

Receptor Information

>4x3i Chain A (length=72) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FPGLDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWE
FKQGSVKNWVEFKKEFLQYSEG

Ligand information

>4x3i Chain B (length=7) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ATRNFSG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4x3i Structural basis of arc binding to synaptic proteins: implications for cognitive disease.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	D210 T211 Q212 I213 F214 E215 F220 H223 L224 Y227 H245 N247 F271
Binding residue (residue number reindexed from 1)	D5 T6 Q7 I8 F9 E10 F15 H18 L19 Y22 H40 N42 F66

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding

	Biological Process
GO:0050804	modulation of chemical synaptic transmission
GO:2000969	positive regulation of AMPA receptor activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4x3i, PDBe:4x3i, PDBj:4x3i
PDBsum	4x3i
PubMed	25864631
UniProt	Q63053\|ARC_RAT Activity-regulated cytoskeleton-associated protein (Gene Name=Arc)

[Back to BioLiP]