Structure of PDB 4x3h Chain A Binding Site BS01

Receptor Information

>4x3h Chain A (length=79) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPLGSPEFPGLDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNG
PAKKWWEFKQGSVKNWVEFKKEFLQYSEG

Ligand information

>4x3h Chain B (length=9) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RIPSYRYRY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4x3h Structural basis of arc binding to synaptic proteins: implications for cognitive disease.
Resolution	2.401 Å
Binding residue (original residue number in PDB)	F206 D210 T211 Q212 I213 F214 E215 F220 H223 L224 H245 N247 F271 Y274
Binding residue (residue number reindexed from 1)	F8 D12 T13 Q14 I15 F16 E17 F22 H25 L26 H47 N49 F73 Y76

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding

	Biological Process
GO:0050804	modulation of chemical synaptic transmission
GO:2000969	positive regulation of AMPA receptor activity

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4x3h, PDBe:4x3h, PDBj:4x3h
PDBsum	4x3h
PubMed	25864631
UniProt	Q63053\|ARC_RAT Activity-regulated cytoskeleton-associated protein (Gene Name=Arc)

[Back to BioLiP]