Structure of PDB 4x3g Chain A Binding Site BS01

Receptor Information
>4x3g Chain A (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPASCKWQGSL
DAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFML
VLEKQEKYQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIH
EGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x3g Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide
Resolution2.34 Å
Binding residue
(original residue number in PDB)		L158 I163 V164 F165 L166 T168 D177 W178 V179 M180
Binding residue
(residue number reindexed from 1)		L67 I72 V73 F74 L75 T77 D86 W87 V88 M89
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007275 multicellular organism development
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4x3g, PDBe:4x3g, PDBj:4x3g
PDBsum4x3g
PubMed
UniProtQ8IUQ4|SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 (Gene Name=SIAH1)

[Back to BioLiP]