Structure of PDB 4x2h Chain A Binding Site BS01

Receptor Information
>4x2h Chain A (length=192) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTPLPQLPSNVRDGENNVASTFLQAFFQLWDHDRLTLIPQFYDSETTFSV
VFATDSPQDPASSSCSKFSRNLNILSPRHPSTLQRLFVGSNLIADLWKVL
PATRHPSLDQTSQWLIDCHTFPHLADPTGMAPYAMGLMINVNGQCEEADI
SQNLYGTRTFSRCFILGPSKPGAPHPYRVLSDQLTLHTWKPQ
Ligand information
>4x2h Chain C (length=6) Species: 209285 (Thermochaetoides thermophila) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QVNNPF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x2h Structural Characterization of the Chaetomium thermophilum TREX-2 Complex and its Interaction with the mRNA Nuclear Export Factor Mex67:Mtr2.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		N380 V382 D490 A495 Y497 A498 M499 G500 L501 L530 G531 P532
Binding residue
(residue number reindexed from 1)		N16 V18 D126 A131 Y133 A134 M135 G136 L137 L166 G167 P168
Enzymatic activity
Enzyme Commision number ?
External links