Structure of PDB 4x1v Chain A Binding Site BS01

Receptor Information
>4x1v Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPS
NFVKELEVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x1v Crystal structure of the 2nd SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 76-91) from human ARAP1
Resolution1.58 Å
Binding residue
(original residue number in PDB)		L116 F117 D125 E126 V141 E142 W145 L156 N160 F161
Binding residue
(residue number reindexed from 1)		L7 F8 D16 E17 V32 E33 W36 L47 N51 F52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4x1v, PDBe:4x1v, PDBj:4x1v
PDBsum4x1v
PubMed
UniProtQ9Y5K6|CD2AP_HUMAN CD2-associated protein (Gene Name=CD2AP)

[Back to BioLiP]