Structure of PDB 4wzs Chain A Binding Site BS01

Receptor Information
>4wzs Chain A (length=66) Species: 284813 (Encephalitozoon cuniculi GB-M1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PISRLKRIMQLNEDIGKIGASVPVVASKAIEMFLTEIVGLTLKEASEFII
RATESDPKFAFLKNME
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wzs Structural basis for recognition and remodeling of the TBP:DNA:NC2 complex by Mot1.
Resolution3.78 Å
Binding residue
(original residue number in PDB)		G33 A34
Binding residue
(residue number reindexed from 1)		G19 A20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001046 core promoter sequence-specific DNA binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006366 transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wzs, PDBe:4wzs, PDBj:4wzs
PDBsum4wzs
PubMed26258880
UniProtQ8SQT6

[Back to BioLiP]