Structure of PDB 4wx9 Chain A Binding Site BS01

Receptor Information
>4wx9 Chain A (length=161) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTSRTHWTPDPGAFSGAVDQL
NAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGA
PGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEK
SRAPADLTLFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wx9 Crystal structure of Mycobacterium tuberculosis O6-methylguanine-DNA methyltransferase protein clusters assembled on to damaged DNA.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y95 A108 R109 G112 L113 N115 G116 C126 A132 T137 G138 Y139 G140
Binding residue
(residue number reindexed from 1)		Y91 A104 R105 G108 L109 N111 G112 C122 A128 T133 G134 Y135 G136
Enzymatic activity
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
GO:0008168 methyltransferase activity
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006307 DNA alkylation repair
GO:0032259 methylation
GO:0051409 response to nitrosative stress
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wx9, PDBe:4wx9, PDBj:4wx9
PDBsum4wx9
PubMed26512127
UniProtP9WJW5|OGT_MYCTU Methylated-DNA--protein-cysteine methyltransferase (Gene Name=ogt)

[Back to BioLiP]