Structure of PDB 4wx6 Chain A Binding Site BS01

Receptor Information

>4wx6 Chain A (length=204) Species: 31545 (Human adenovirus D8)

SGSSEQELAAIVRDLGCGPYFLGTHDKRFPGFLAGNKLACAIVNTAGRET
GGVHWLAFGWNPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALALS
PDRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLL
TGVPNGMLQSPQVLPTLRRNQEKLYRFLAHHSPYFRSHRAAIEHATAFDK
MKQL

Ligand information

>4wx6 Chain B (length=11) Species: 31545 (Human adenovirus D8)

GVKSLKRRRCY

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4wx6 Structure-based design and optimization of potent inhibitors of the adenoviral protease.
• Resolution: 2.15 Å
• Binding residue (original residue number in PDB): R93 R103 C104 L105 L107 E108 Q109 S110 T111 Q112 M141 D142 M147 L150 G152
• Binding residue (residue number reindexed from 1): R93 R103 C104 L105 L107 E108 Q109 S110 T111 Q112 M141 D142 M147 L150 G152

Enzymatic activity

• Catalytic site (original residue number in PDB): H54 D71 Q115 C122
• Catalytic site (residue number reindexed from 1): H54 D71 Q115 C122
• Enzyme Commision number: 3.4.22.39: adenain.

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004197 cysteine-type endopeptidase activity
• GO:0008234 cysteine-type peptidase activity

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0042025 host cell nucleus
• GO:0044423 virion component

External links

• PDB: RCSB:4wx6, PDBe:4wx6, PDBj:4wx6
• PDBsum: 4wx6
• PubMed: 25571794
• UniProt: B9A5C1