Structure of PDB 4wwc Chain A Binding Site BS01

Receptor Information
>4wwc Chain A (length=213) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMNINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRM
TVRQALSNLVNEGLLYRLKGRGTFVSKPKMQGLTSFTEDMKSRGMTPGSR
LIDYQLIDSTEELAAILGCGHSSIHKITRVRLANDIPMAIESSHIPFEIS
RAKQELEPSAATTEEANILGIQKGAPVLLIKRTTYLQNGTAFEHAKSVYR
GDRYTFVHYMDRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wwc Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR.
Resolution2.903 Å
Binding residue
(original residue number in PDB)		P10 I11 Y12 S47 T50 R70
Binding residue
(residue number reindexed from 1)		P11 I12 Y13 S48 T51 R71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4wwc, PDBe:4wwc, PDBj:4wwc
PDBsum4wwc
PubMed25564531
UniProtO34817|NAGR_BACSU HTH-type transcriptional repressor NagR (Gene Name=nagR)

[Back to BioLiP]