Structure of PDB 4wkm Chain A Binding Site BS01

Receptor Information

>4wkm Chain A (length=197) Species: 1006003 (Citrobacter freundii ATCC 8090 = MTCC 1658 = NBRC 12681) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QEKLKIGVVGTFAIGCLFPLLSDFKRSYPHIDLHISTHNNRVDPAAEGLD
YTIRYGGGAWHDTDAQYLCSALMSPLCSPTLASQIQTPADILKFPLLRSY
RRDEWALWMQTVGEAPPSPTHNVMVFDSSVTMLEAAQAGMGVAIAPVRMF
THLLSSERIVQPFLTQIDLGSYWITRLQSRPETPAMREFSRWLTGVL

Ligand information

>4wkm Chain I (length=5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AEtAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wkm The beta-Lactamase Gene Regulator AmpR Is a Tetramer That Recognizes and Binds the d-Ala-d-Ala Motif of Its Repressor UDP-N-acetylmuramic Acid (MurNAc)-pentapeptide.
Resolution	2.15 Å
Binding residue (original residue number in PDB)	T103 N131 N132 R133 Y147 W152 S191 Y192 R193 D219 S220 S221 P238 Y264
Binding residue (residue number reindexed from 1)	T11 N39 N40 R41 Y55 W60 S99 Y100 R101 D127 S128 S129 P146 Y172

External links

PDB	RCSB:4wkm, PDBe:4wkm, PDBj:4wkm
PDBsum	4wkm
PubMed	25480792

[Back to BioLiP]