Structure of PDB 4wjn Chain A Binding Site BS01

Receptor Information
>4wjn Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFE
GQRIADNHTPKELGMEEEDVIEVYQEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wjn Structural and Functional Characterization of the Phosphorylation-Dependent Interaction between PML and SUMO1.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Y21 E33 I34 H35 F36 K37 H43 K46 R54
Binding residue
(residue number reindexed from 1)		Y4 E16 I17 H18 F19 K20 H26 K29 R37
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4wjn, PDBe:4wjn, PDBj:4wjn
PDBsum4wjn
PubMed25497731
UniProtP63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 (Gene Name=SUMO1)

[Back to BioLiP]