Structure of PDB 4wj7 Chain A Binding Site BS01

Receptor Information
>4wj7 Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGH
LTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVV
LKTAQDEACCLVILAAESKVAAEELCCLLGQVFQVVY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wj7 Structural Basis for the Disruption of the Cerebral Cavernous Malformations 2 (CCM2) Interaction with Krev Interaction Trapped 1 (KRIT1) by Disease-associated Mutations.
Resolution2.753 Å
Binding residue
(original residue number in PDB)		P82 S83 H137 D138 I139 A140 A141 V142 S143 Y144 R146 A158 C210 F217
Binding residue
(residue number reindexed from 1)		P28 S29 H83 D84 I85 A86 A87 V88 S89 Y90 R92 A104 C126 F133
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4wj7, PDBe:4wj7, PDBj:4wj7
PDBsum4wj7
PubMed25525273
UniProtQ9BSQ5|CCM2_HUMAN Cerebral cavernous malformations 2 protein (Gene Name=CCM2)

[Back to BioLiP]