Structure of PDB 4wfd Chain A Binding Site BS01

Receptor Information
>4wfd Chain A (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMA
NEIILSIDEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAIN
Ligand information
>4wfd Chain C (length=14) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TDLFDVFEETPVEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wfd The exosome-binding factors Rrp6 and Rrp47 form a composite surface for recruiting the Mtr4 helicase.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R18 S21 S25 Q26
Binding residue
(residue number reindexed from 1)		R15 S18 S22 Q23
Enzymatic activity
Enzyme Commision number 3.1.13.-
Gene Ontology
Cellular Component
GO:0000176 nuclear exosome (RNase complex)

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wfd, PDBe:4wfd, PDBj:4wfd
PDBsum4wfd
PubMed25319414
UniProtQ12149|RRP6_YEAST Exosome complex exonuclease RRP6 (Gene Name=RRP6)

[Back to BioLiP]