Structure of PDB 4wb2 Chain A Binding Site BS01

Receptor Information
>4wb2 Chain A (length=69) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPL
CIRAFNECCTIANKIRKES
Ligand information
>4wb2 Chain D (length=40) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgaugugguggugcaggguuguugggugucgacgcacgc
<<<.<<<.<<......................>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wb2 Structural basis for the targeting of complement anaphylatoxin C5a using a mixed L-RNA/L-DNA aptamer.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R684 E688 H696 S697 V698 K700 K701 Y704 D705 R708 F711 R718 R721 V722 T723 I724
Binding residue
(residue number reindexed from 1)		R7 E11 H19 S20 V21 K23 K24 Y27 D28 R31 F34 R41 R44 V45 T46 I47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006954 inflammatory response
GO:0006956 complement activation
Cellular Component
GO:0005576 extracellular region

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wb2, PDBe:4wb2, PDBj:4wb2
PDBsum4wb2
PubMed25901944
UniProtP06684|CO5_MOUSE Complement C5 (Gene Name=C5)

[Back to BioLiP]