Structure of PDB 4wan Chain A Binding Site BS01

Receptor Information
>4wan Chain A (length=124) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGS
VKEGKNASDLPPGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTS
PEGQNDLKRGQLRELAELNGTLRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wan Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V165 G166 L169 G170 P171 R172 G173 L176 R177 K186 I189 R190 K196 P205 E246 G247 N249 K252 R253 Q255 L256 L259 T265
Binding residue
(residue number reindexed from 1)		V21 G22 L25 G26 P27 R28 G29 L32 R33 K42 I45 R46 K52 P61 E102 G103 N105 K108 R109 Q111 L112 L115 T121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4wan, PDBe:4wan, PDBj:4wan
PDBsum4wan
PubMed25587180
UniProtQ12186|BBP_YEAST Branchpoint-bridging protein (Gene Name=MSL5)

[Back to BioLiP]