Structure of PDB 4wal Chain A Binding Site BS01

Receptor Information
>4wal Chain A (length=127) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGS
VKEGKNASDLPPGAMNFEDPLHCLIMADSEDKMQKGIKVCQNIMIKAVTS
PEGQNDLKRGQLRELAELNGTLREDNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wal Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		V165 G166 L169 G170 P171 R172 G173 L176 R177 I189 R190 K196 P205 G247 Q248 N249 K252 R253 Q255 L256 R257 L259 A260 R267
Binding residue
(residue number reindexed from 1)		V21 G22 L25 G26 P27 R28 G29 L32 R33 I45 R46 K52 P61 G103 Q104 N105 K108 R109 Q111 L112 R113 L115 A116 R123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4wal, PDBe:4wal, PDBj:4wal
PDBsum4wal
PubMed25587180
UniProtQ12186|BBP_YEAST Branchpoint-bridging protein (Gene Name=MSL5)

[Back to BioLiP]