Structure of PDB 4w8h Chain A Binding Site BS01

Receptor Information
>4w8h Chain A (length=127) Species: 6087 (Hydra vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKTYDVNICYAPEDREWVINTLVFKLERAGIKTFVNIRDDTPGNFFAENI
MDAIENSNRTIVVMSPDFFKNNICDKTLQIGLSHQIIPILYRPCEVPYFL
NHMTYLDWCDKDVRPVFWRNLFRDIRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4w8h Crystal structure of the TIR domain of the Toll-related Receptor TRR-2 from the lower metazoan Hydra magnipapillata (crystal form II)
Resolution1.14 Å
Binding residue
(original residue number in PDB)		R152 Q178 I179 D217 N220
Binding residue
(residue number reindexed from 1)		R59 Q85 I86 D124 N127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007165 signal transduction

View graph for
Biological Process
External links
PDB RCSB:4w8h, PDBe:4w8h, PDBj:4w8h
PDBsum4w8h
PubMed
UniProtA6M946

[Back to BioLiP]