Structure of PDB 4v11 Chain A Binding Site BS01

Receptor Information
>4v11 Chain A (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGK
RLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKND
AIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v11 Phosphorylation of Synaptic Vesicle Protein 2A at Thr84 by Casein Kinase 1 Family Kinases Controls the Specific Retrieval of Synaptotagmin-1.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		K314 K326 K327 K328 E342 S343 F344 S345
Binding residue
(residue number reindexed from 1)		K42 K54 K55 K56 E70 S71 F72 S73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:4v11, PDBe:4v11, PDBj:4v11
PDBsum4v11
PubMed25673844
UniProtP21579|SYT1_HUMAN Synaptotagmin-1 (Gene Name=SYT1)

[Back to BioLiP]