Structure of PDB 4v0h Chain A Binding Site BS01

Receptor Information

>4v0h Chain A (length=220) Species: 9606 (Homo sapiens)

TEPLCGASPLLVPGDPYSVVVLLQGYAEPEGVGDAVRADGSVTLVLPQGA
EAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSD
HIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPG
HGGQRDVSVVVAGTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRK
RVLVVADVVVPGHGPPFRVL

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 4v0h Chain A Residue 1242

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v0h Biosynthesis of histone messenger RNA employs a specific 3' end endonuclease.
• Resolution: 1.79 Å
• Binding residue (original residue number in PDB): H117 H119 H122 H172 D195
• Binding residue (residue number reindexed from 1): H96 H98 H101 H151 D174
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 3.1.27.-

Gene Ontology

Molecular Function

• GO:0004521 RNA endonuclease activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008334 histone mRNA metabolic process
• GO:0031124 mRNA 3'-end processing
• GO:1900087 positive regulation of G1/S transition of mitotic cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4v0h, PDBe:4v0h, PDBj:4v0h
• PDBsum: 4v0h
• PubMed: 30507380
• UniProt: A4D2B0|MBLC1_HUMAN Metallo-beta-lactamase domain-containing protein 1 (Gene Name=MBLAC1)