Structure of PDB 4uzb Chain A Binding Site BS01

Receptor Information
>4uzb Chain A (length=137) Species: 37296 (Human gammaherpesvirus 8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHPRYQQPPVPYRQIDDCPAKARPQHIFYQQFLGKDGRRDPKCQWEFAVI
FWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNA
ATSKKVQMARLEWEASHPLAGNLQSSIVSFDDPLPLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uzb The 3D Structure of Kaposi Sarcoma Herpesvirus Lana C-Terminal Domain Bound to DNA.
Resolution2.865 Å
Binding residue
(original residue number in PDB)		H1011 P1012 R1013 Y1014 P1033 Y1066 K1070 W1122 L1128 A1129 G1130
Binding residue
(residue number reindexed from 1)		H2 P3 R4 Y5 P24 Y57 K61 W113 L119 A120 G121
Binding affinityPDBbind-CN: Kd=72nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4uzb, PDBe:4uzb, PDBj:4uzb
PDBsum4uzb
PubMed25947153
UniProtQ9QR71|LANA1_HHV8P Protein LANA1 (Gene Name=LANA1)

[Back to BioLiP]