Structure of PDB 4uyk Chain A Binding Site BS01

Receptor Information

>4uyk Chain A (length=82) Species: 9606 (Homo sapiens)

PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVY
KTDQAQDVKKIEKFHSQLMRLMVAKEARNVTM

Ligand information

>4uyk Chain R (length=134)

ggggcuaggccgggggguucggcguccccuguaaccggaaaccgccgaua
ugccggggccgaagcccgaggggcgguucccgaagccgccucuguaagga
ggcgguggaggguucccacccucgggcgugccuc

<<<<<..<<<<<<<<<<..(((((>>>>>>....<<<<....)))))...
..>>>>>>>>...<<<<<<<<<..<<..<<<...<<<<<<<<<....>>>
>>>>>>...>>>..>>..>>>>>>>>>..>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4uyk Crystal Structure of a Signal Recognition Particle Alu Domain in the Elongation Arrest Conformation.
• Resolution: 3.22 Å
• Binding residue (original residue number in PDB): R26 K30 R32 K41 D45 L46 C48 K52
• Binding residue (residue number reindexed from 1): R25 K29 R31 K40 D44 L45 C47 K51

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005047 signal recognition particle binding
• GO:0005515 protein binding
• GO:0008312 7S RNA binding

Biological Process

• GO:0006614 SRP-dependent cotranslational protein targeting to membrane
• GO:0045900 negative regulation of translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005785 signal recognition particle receptor complex
• GO:0005786 signal recognition particle, endoplasmic reticulum targeting
• GO:0005829 cytosol
• GO:0048500 signal recognition particle

External links

• PDB: RCSB:4uyk, PDBe:4uyk, PDBj:4uyk
• PDBsum: 4uyk
• PubMed: 25336584
• UniProt: P49458|SRP09_HUMAN Signal recognition particle 9 kDa protein (Gene Name=SRP9)