Structure of PDB 4uus Chain A Binding Site BS01

Receptor Information
>4uus Chain A (length=67) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRR
MKLKKEIQAIKELNEQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uus A Flexible Extension of the Drosophila Ultrabithorax Homeodomain Defines a Novel Hox/Pbc Interaction Mode.
Resolution2.55 Å
Binding residue
(original residue number in PDB)
R5 Y25 R28 R31 K46 Q50 R53 M54
Binding residue
(residue number reindexed from 1)
R2 Y22 R25 R28 K43 Q47 R50 M51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4uus, PDBe:4uus, PDBj:4uus
PDBsum4uus
PubMed25651060
UniProtP83949|UBX_DROME Homeotic protein ultrabithorax (Gene Name=Ubx)

[Back to BioLiP]