Structure of PDB 4uqz Chain A Binding Site BS01

Receptor Information
>4uqz Chain A (length=258) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWARAQN
QLKVVGELDASALPMVQTYSTAIDCEALRREVFAGRLTPVILGQPAEWIA
PLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAPFAWLADADTRL
GPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATV
ALLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDL
RELDFEPT
Ligand information
>4uqz Chain B (length=24) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QKFIARNRAPRVQIEYDVELYGAE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uqz Coevolution of the ATPase Clpv, the Sheath Proteins Tssb and Tssc and the Accessory Protein Tagj/Hsie1 Distinguishes Type Vi Secretion Classes.
Resolution1.599 Å
Binding residue
(original residue number in PDB)		E32 R36 I62 F63 Q66 M94 F154 D155 A157 P158 W171 A173 S208 D209 L210 R211 R251 K252 T253 W255 E273 A275 F277 D278
Binding residue
(residue number reindexed from 1)		E3 R7 I33 F34 Q37 M65 F125 D126 A128 P129 W142 A144 S179 D180 L181 R182 R222 K223 T224 W226 E244 A246 F248 D249
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4uqz, PDBe:4uqz, PDBj:4uqz
PDBsum4uqz
PubMed25305017
UniProtQ9I746|TAGJ_PSEAE Type VI secretion system accessory component TagJ (Gene Name=tagJ)

[Back to BioLiP]