Structure of PDB 4uqm Chain A Binding Site BS01

Receptor Information
>4uqm Chain A (length=229) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPIIPANLPEDWQEALLPEFSAPYFHELTDFLRQERKEYTIYPPAPDVFN
ALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPGVRVPPSLRNIYKEL
TEDIPGFVAPKHGYLRSWAEQGVLLLNAVLTVRAAQANSHQGKGWEHFTD
AVIKAVNAKEERVVFILWGSYARKKKKLITGKNHVVIESGHPSPLSEQYF
FGTRPFSKTNEALEKAGRGPVEWQLPATV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uqm Structure determination of uracil-DNA N-glycosylase from Deinococcus radiodurans in complex with DNA.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		D83 H86 P106 S107 G184 S185 G205 H206 S208 P209 L210 S211 Y214
Binding residue
(residue number reindexed from 1)		D68 H71 P91 S92 G169 S170 G190 H191 S193 P194 L195 S196 Y199
Enzymatic activity
Catalytic site (original residue number in PDB) D83 Y85 F96 H206
Catalytic site (residue number reindexed from 1) D68 Y70 F81 H191
Enzyme Commision number 3.2.2.27: uracil-DNA glycosylase.
Gene Ontology
Molecular Function
GO:0004844 uracil DNA N-glycosylase activity
GO:0016787 hydrolase activity
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0097510 base-excision repair, AP site formation via deaminated base removal
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4uqm, PDBe:4uqm, PDBj:4uqm
PDBsum4uqm
PubMed26457437
UniProtQ9RWH9|UNG_DEIRA Uracil-DNA glycosylase (Gene Name=ung)

[Back to BioLiP]