Structure of PDB 4uno Chain A Binding Site BS01

Receptor Information

>4uno Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPA
MNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPD

Ligand information

>4uno Chain B (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

accggaagtg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4uno Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	Y419 R424 R427 Y430 K437 R442 Y443
Binding residue (residue number reindexed from 1)	Y53 R58 R61 Y64 K71 R76 Y77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4uno, PDBe:4uno, PDBj:4uno
PDBsum	4uno
PubMed	25866208
UniProt	P41161\|ETV5_HUMAN ETS translocation variant 5 (Gene Name=ETV5)

[Back to BioLiP]