Structure of PDB 4uf1 Chain A Binding Site BS01

Receptor Information
>4uf1 Chain A (length=135) Species: 305676 (Deerpox virus W-1170-84) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAIEFDEIVKKLLNIYINDICTTGEKRLLNNYEKSILDRIYKSCEYIKKN
YELDFNSMYNQININNITTSDIKSKIIEALLIDSRPSVKLATLSFISLIA
EKWGEKNRAKIMEILSNEIVEKISNNGKDFIDFID
Ligand information
>4uf1 Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STMGQVGRQLAIIGDDINRRYD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4uf1 Structural Basis of Deerpox Virus-Mediated Inhibition of Apoptosis.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		I49 Y53 M60 Q63 E80 A81 I84 R87 S89 A93 T94 F135
Binding residue
(residue number reindexed from 1)		I47 Y51 M58 Q61 E78 A79 I82 R85 S87 A91 T92 F133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4uf1, PDBe:4uf1, PDBj:4uf1
PDBsum4uf1
PubMed26249341
UniProtQ08FX8|DPV22_DPV83 Apoptosis regulator DPV022 (Gene Name=DPV022)

[Back to BioLiP]