Structure of PDB 4ud7 Chain A Binding Site BS01

Receptor Information
>4ud7 Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTK
RLYDAAQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ud7 Benzene Probes in Molecular Dynamics Simulations Reveal Novel Binding Sites for Ligand Design.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
M50 L54 F55 G58 I61 M62 Y67 Q72 H73 V93 H96 Y100 Y104
Binding residue
(residue number reindexed from 1)
M36 L40 F41 G44 I47 M48 Y53 Q58 H59 V79 H82 Y86 Y90
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4ud7, PDBe:4ud7, PDBj:4ud7
PDBsum4ud7
PubMed27532490
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]