Structure of PDB 4u7i Chain A Binding Site BS01

Receptor Information
>4u7i Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGIS
ISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLAT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u7i Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
Resolution1.794 Å
Binding residue
(original residue number in PDB)		Y20 F24 V27 L31 N32 D34 E35 Y46 K80 T84 N87 R91 T101
Binding residue
(residue number reindexed from 1)		Y12 F16 V19 L23 N24 D26 E27 Y38 K72 T76 N79 R83 T93
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4u7i, PDBe:4u7i, PDBj:4u7i
PDBsum4u7i
PubMed25657007
UniProtQ8N0X7|SPART_HUMAN Spartin (Gene Name=SPART)

[Back to BioLiP]