Structure of PDB 4u68 Chain A Binding Site BS01

Receptor Information
>4u68 Chain A (length=64) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFE
SEVFRLHRKAAAKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u68 Structural insights into Rhino-mediated germline piRNA cluster formation
Resolution1.8 Å
Binding residue
(original residue number in PDB)
E23 Y24 V25 V26 W45 E56 N60 N63 C64 K66 L67
Binding residue
(residue number reindexed from 1)
E1 Y2 V3 V4 W23 E34 N38 N41 C42 K44 L45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4u68, PDBe:4u68, PDBj:4u68
PDBsum4u68
PubMed25613572
UniProtQ7JXA8|RHINO_DROME Chromo domain-containing protein rhino (Gene Name=rhi)

[Back to BioLiP]