Structure of PDB 4u2w Chain A Binding Site BS01

Receptor Information

>4u2w Chain A (length=223) Species: 9913 (Bos taurus)

IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRL
GEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRV
ASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKS
AYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQK
NKPGVYTKVCNYVSWIKQTIASN

Ligand information

>4u2w Chain B (length=15) Species: 326940 (Odorrana versabilis)

GCWTKSIPPRPCFVK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4u2w Atomic resolution crystal structure of HV-BBI protease inhibitor from amphibian skin in complex with bovine trypsin.
• Resolution: 1.0 Å
• Binding residue (original residue number in PDB): F47 H63 N102 T103 L104 Q178 D194 S195 C196 Q197 G198 S200 S215 W216 G217 S218
• Binding residue (residue number reindexed from 1): F24 H40 N79 T80 L81 Q155 D171 S172 C173 Q174 G175 S177 S192 W193 G194 S195

Enzymatic activity

• Catalytic site (original residue number in PDB): G198 S200 G201
• Catalytic site (residue number reindexed from 1): G175 S177 G178
• Enzyme Commision number: 3.4.21.4: trypsin.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004252 serine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0008236 serine-type peptidase activity
• GO:0046872 metal ion binding
• GO:0097655 serpin family protein binding

Biological Process

• GO:0006508 proteolysis
• GO:0007586 digestion

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0097180 serine protease inhibitor complex

External links

• PDB: RCSB:4u2w, PDBe:4u2w, PDBj:4u2w
• PDBsum: 4u2w
• PubMed: 25546528
• UniProt: P00760|TRY1_BOVIN Serine protease 1 (Gene Name=PRSS1)