Structure of PDB 4tzv Chain A Binding Site BS01

Receptor Information
>4tzv Chain A (length=81) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAED
QGISVSMVESMKKLGKACGIEVGAAAVAIIL
Ligand information
>4tzv Chain C (length=102) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggugcgaugagaagaagaguauuaaggauuuacuaugauuagcgacucu
aggauagugaaagcuagaggauaguaaccuuaagaaggcacuucgagcac
cc
<<<<<<.....<<<<.......<<<<<<..<<<<<<<.........<<<<
<<...........>>>>>>.>>>>>>>>>>>>>.......>>>>..>>>>
>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzv Dramatic Improvement of Crystals of Large RNAs by Cation Replacement and Dehydration.
Resolution5.03 Å
Binding residue
(original residue number in PDB)		G15 Q18 A37 M62 V73 G74 A75 A76
Binding residue
(residue number reindexed from 1)		G14 Q17 A36 M61 V72 G73 A74 A75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4tzv, PDBe:4tzv, PDBj:4tzv
PDBsum4tzv
PubMed25185828
UniProtP46350|RXL7_BACSU RNA-binding protein YbxF (Gene Name=rulS)

[Back to BioLiP]