Structure of PDB 4tzs Chain A Binding Site BS01

Receptor Information
>4tzs Chain A (length=229) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFS
KNYITENLSCMTLSFKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHD
GDVEAIEVFSMKFIYFENGGVVARLSTDPHFAELAQLRYEGAESVRDQMV
TIVRSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYT
LPDGIQSVTIGHLRPGHHAAHMQCWSKSM
Ligand information
>4tzs Chain C (length=17) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NARDSPYGLSQGITKKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzs The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		E61 E192 F193 T194 A195 F197 R198 L199 K200 Y201 S207 N208 F209 R210 F214 D215 S217 F220
Binding residue
(residue number reindexed from 1)		E45 E170 F171 T172 A173 F175 R176 L177 K178 Y179 S185 N186 F187 R188 F192 D193 S195 F198
Enzymatic activity
Enzyme Commision number ?
External links