Structure of PDB 4tzp Chain A Binding Site BS01

Receptor Information
>4tzp Chain A (length=81) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAED
QGISVSMVESMKKLGKACGIEVGAAAVAIIL
Ligand information
>4tzp Chain C (length=102) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggugcgaugagaagaagaguauuaaggauuuacuaugauuagcgacucu
aggauagugaaagcuagaggauaguaaccuuaagaaggcacuucgagcac
cc
<<<<<<.....<<<<.......<<<<<<..<<<<<<<.........<<<<
<<...........>>>>>>.>>>>>>>>>>>>>.......>>>>..>>>>
>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzp Dramatic Improvement of Crystals of Large RNAs by Cation Replacement and Dehydration.
Resolution8.503 Å
Binding residue
(original residue number in PDB)		I14 Q18 I71 E72 V73
Binding residue
(residue number reindexed from 1)		I13 Q17 I70 E71 V72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4tzp, PDBe:4tzp, PDBj:4tzp
PDBsum4tzp
PubMed25185828
UniProtP46350|RXL7_BACSU RNA-binding protein YbxF (Gene Name=rulS)

[Back to BioLiP]