Structure of PDB 4tzn Chain A Binding Site BS01

Receptor Information
>4tzn Chain A (length=227) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFS
KNYITENLSCMTLSFKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHD
GDVEAIEVFSMKFIYFENGGVVARLDPHFAELAQLRYEGAESVRDQMVTI
VRSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTLP
DGIQSVTIGHLRPGHHAAHMQCWSKSM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzn The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
Resolution3.115 Å
Binding residue
(original residue number in PDB)		R85 I89 T194 A195 N196 F197 R198 L199 K200 Y201 P206 F209 F214 D215 D216 S217 T219 F220
Binding residue
(residue number reindexed from 1)		R69 I73 T170 A171 N172 F173 R174 L175 K176 Y177 P182 F185 F190 D191 D192 S193 T195 F196
Enzymatic activity
Enzyme Commision number ?
External links