Structure of PDB 4tzm Chain A Binding Site BS01

Receptor Information
>4tzm Chain A (length=239) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNYNESLNKSKDAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLR
QRNILEKEYFSKNYITENLSCMTLSFKNLRAHQIAQLLRAAGDATKDGFL
KEISLVVTEHDGDVEAIEVFSMKFIYFENGGVVARLEDPHFAELAQLRYE
GAESVRDQMVTIVRSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRID
GFDDSSTFYTLPDGIQSVTIGHLRPGHHAAHMQCWSKSM
Ligand information
>4tzm Chain C (length=13) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARYGVSNTSINRK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzm The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		L60 R85 A191 F193 T194 A195 N196 F197 R198 L199 K200 Y201 F209 R210 G213 F214 D215 D216 S217 T219
Binding residue
(residue number reindexed from 1)		L55 R80 A179 F181 T182 A183 N184 F185 R186 L187 K188 Y189 F197 R198 G201 F202 D203 D204 S205 T207
Enzymatic activity
Enzyme Commision number ?
External links