Structure of PDB 4tzl Chain A Binding Site BS01

Receptor Information
>4tzl Chain A (length=228) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNILEKEYFS
KNYITENLSCMTLSFKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHD
GDVEAIEVFSMKFIYFENGGVVARLEDPHFAELAQLRYEGAESVRDQMVT
IVRSVQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTL
PDGIQSVTIGHLRPGHHAAHMQCWSKSM
Ligand information
>4tzl Chain C (length=14) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NARDSPYGLSQGIT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzl The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
Resolution2.537 Å
Binding residue
(original residue number in PDB)		R85 L92 F193 T194 A195 N196 F197 R198 L199 K200 Y201 S207 F209 R210 G213 F214 D215 D216 S217 S218 T219 F220
Binding residue
(residue number reindexed from 1)		R69 L76 F170 T171 A172 N173 F174 R175 L176 K177 Y178 S184 F186 R187 G190 F191 D192 D193 S194 S195 T196 F197
Enzymatic activity
Enzyme Commision number ?
External links