Structure of PDB 4twj Chain A Binding Site BS01

Receptor Information

>4twj Chain A (length=236) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

MEDEIRKAAEILAKSKHAVVFTGAGISAEPEEVASISGFKRNPRAFWEFS
MEMKDKLFAEPNPAHYAIAELERMGIVKAVITQNIDMLHQRAGSRRVLEL
HGSMDKLDCLDCHETYDWSEFVEDFNKGEIPRCRKCGSYYVKPRVVLFGE
PLPQRTLFEAIEEAKHCDAFMVVGSSLVVYPAAELPYIAKKAGAKMIIVN
AEPTMADPIFDVKIIGKAGEVLPKIVEEVKRLRSEK

Ligand information

>4twj Chain B (length=10) Species: 559292 (Saccharomyces cerevisiae S288C)

KGGAKRHRKW

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4twj Alternate deacylating specificities of the archaeal sirtuins Sir2Af1 and Sir2Af2.
• Resolution: 1.65 Å
• Binding residue (original residue number in PDB): S67 H118 V163 F165 G166 E167 V195 V196 Y197 P198
• Binding residue (residue number reindexed from 1): S50 H101 V146 F148 G149 E150 V178 V179 Y180 P181

Enzymatic activity

• Catalytic site (original residue number in PDB): N101 D103 H118
• Catalytic site (residue number reindexed from 1): N84 D86 H101
• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0016740 transferase activity
• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0034979 NAD-dependent protein lysine deacetylase activity
• GO:0036054 protein-malonyllysine demalonylase activity
• GO:0036055 protein-succinyllysine desuccinylase activity
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006476 protein deacetylation
• GO:0036049 peptidyl-lysine desuccinylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4twj, PDBe:4twj, PDBj:4twj
• PDBsum: 4twj
• PubMed: 25200501
• UniProt: O30124|NPD2_ARCFU NAD-dependent protein deacylase 2 (Gene Name=cobB2)