Structure of PDB 4twi Chain A Binding Site BS01

Receptor Information

>4twi Chain A (length=244) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

DEKLLKTIAESKYLVALTGAGVSAESGIPTFRGKDGLWNRYRPEELANPQ
AFAKDPEKVWKWYAWRMEKVFNAQPNKAHQAFAELERLGVLKCLITQNVD
DLHERAGSRNVIHLHGSLRVVRCTSCNNSFEVESAPKIPPLPKCDKCGSL
LRPGVVWFGEMLPPDVLDRAMREVERADVIIVAGTSAVVQPAASLPLIVK
QRGGAIIEINPDETPLTPIADYSLRGKAGEVMDELVRHVRKALS

Ligand information

>4twi Chain B (length=8) Species: 559292 (Saccharomyces cerevisiae S288C)

KGGAKRHR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4twi Alternate deacylating specificities of the archaeal sirtuins Sir2Af1 and Sir2Af2.
• Resolution: 1.79 Å
• Binding residue (original residue number in PDB): Y64 R67 V100 H116 V157 F159 G160 E161 M162 V189 V190 Q191 P192 S195
• Binding residue (residue number reindexed from 1): Y63 R66 V99 H115 V156 F158 G159 E160 M161 V188 V189 Q190 P191 S194

Enzymatic activity

• Catalytic site (original residue number in PDB): P30 T31 F32 R33 N99 D101 H116
• Catalytic site (residue number reindexed from 1): P29 T30 F31 R32 N98 D100 H115
• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0016740 transferase activity
• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0034979 NAD-dependent protein lysine deacetylase activity
• GO:0036054 protein-malonyllysine demalonylase activity
• GO:0036055 protein-succinyllysine desuccinylase activity
• GO:0046872 metal ion binding
• GO:0070403 NAD+ binding

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006476 protein deacetylation
• GO:0036048 protein desuccinylation
• GO:0036049 peptidyl-lysine desuccinylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4twi, PDBe:4twi, PDBj:4twi
• PDBsum: 4twi
• PubMed: 25200501
• UniProt: O28597|NPD1_ARCFU NAD-dependent protein deacylase 1 (Gene Name=cobB1)