Structure of PDB 4tvx Chain A Binding Site BS01

Receptor Information
>4tvx Chain A (length=192) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLSKVIIARAWSRDLYQLHQGLWHLFPDFLFHVEKRNTPEGCHVLLQSA
QMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKG
NIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGK
IQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Ligand information
>4tvx Chain L (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auaaaccgacgguauuguucagauccuggcuugccaacaggaguuccccg
cgccagcgggg
.............................................<<<<<
<....>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tvx Structural biology. Crystal structure of the CRISPR RNA-guided surveillance complex from Escherichia coli.
Resolution3.24 Å
Binding residue
(original residue number in PDB)
Y17 N91 K94 T95 I96 D98 N99 Q100 R102 K110 R111 C112 R113 V114 P115 R128 K129 F149 S155 G156 K157 Q159 K187 S188
Binding residue
(residue number reindexed from 1)
Y17 N84 K87 T88 I89 D91 N92 Q93 R95 K103 R104 C105 R106 V107 P108 R121 K122 F142 S148 G149 K150 Q152 K180 S181
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0006396 RNA processing
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4tvx, PDBe:4tvx, PDBj:4tvx
PDBsum4tvx
PubMed25103409
UniProtQ46897|CAS6_ECOLI CRISPR system Cascade subunit CasE (Gene Name=casE)

[Back to BioLiP]